SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033370 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033370
Domain Number 1 Region: 2919-3207
Classification Level Classification E-value
Superfamily BEACH domain 5.1e-121
Family BEACH domain 0.0000000269
Further Details:      
 
Domain Number 2 Region: 3261-3462,3492-3544
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.18e-30
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 2721-2764,2841-2893
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-17
Family PreBEACH PH-like domain 0.034
Further Details:      
 
Domain Number 4 Region: 236-359,484-634
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000156
Family Plakophilin 1 helical region 0.097
Further Details:      
 
Domain Number 5 Region: 1133-1241
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000222
Family Laminin G-like module 0.077
Further Details:      
 
Domain Number 6 Region: 697-894,925-1006
Classification Level Classification E-value
Superfamily ARM repeat 0.000000304
Family HspBP1 domain 0.079
Further Details:      
 
Weak hits

Sequence:  Bra033370
Domain Number - Region: 1399-1476,1593-1789
Classification Level Classification E-value
Superfamily ARM repeat 0.000576
Family Armadillo repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra033370
Sequence length 3552
Sequence
MKWATLLKDFKEKVGLAQSPDASTSDSFAVDLSAPPSSSASPSSAHPDASSNHRLDFSSS
PSRDNHELELDFKRLWEEFRSSSSEKEKEAALNLTVDTFCRLVKRHANVDQLVTMLVETH
IFCFVIGRAFVTDIEKLKIGSKARSLDVAKVLRFFSDVTKEGFSPGANLLTAVEVLVSAP
IDKQSLLDSGIFCCLILVLSALLAYDEPSKSKTTGLEEVSPDTDAGCRVLQTRRLEVEGS
VVHIMKALASNPSAAQSLIEDDSLEALFNMVANGAVTVFSQYREGLVTLHSIQLHRHAMQ
ILGILLINDSGSTSRYIRKHHLIKVLLMAVKDFDPNCGDSAYTMGIVDLLLECVELSYRP
EANGVRLRDDIRNAHGYHFLVQFALVLSSLPKNQTFVSSRSSVNQDSGSDGSELFPDVEN
TNGREDAGFPTQDFSPSLSRLLDVLVTLAQTGPAEPSVGRATRSSQTKPTGHSRSRTSSV
DSIYDETWEQGSSKVKDLEAVQMLQDIFLKADNKDLQAEVLNRMFKIFSSHVENYRLCQE
LRTVPLLVLNMAGFPPSLQDIILKILEYAVTVVSCVPEQELLSLCCLLQQPITSQLKHTI
LSFFVKLISFDQQYKKVLREVGVLEVLQDDLKQHKLLMGPDQYSGVSDHSDPKPSSGSFK
KHLDTKDAIISSPKLMESGSGKLPVFEVDETITVGWDCLISLLKKAEANQASFRAANGVT
IILPFLISDAHRTGVLRVLSCLITEDTKQVHHEELGAVVDLLKSGMVTGISGHQYKLHDD
AKCDTMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGDKDHMDESDLMVYIKLFKY
LFRLMTAAVCENAVNRMKLHAVITSQTFYELLVESGLLCVELETQVIQLLLELALEVVLP
PFLASESAASAAITESEKTTFVVTTPSGQFNPDKERIYNAGAVRVLIRSLLLFSPKTQLE
FLNLLESLARASPFNQENLTSVGCVELLLEIIYPFLPGSSPFLSYALKIVEILGAYRLSP
SELRILFRYVLQMRIMKSDHAIVEMMEKLILMEDTELDHLSLAPFVEMDMSKTGHASVQV
SLGERSWPPAAGYSFVCWFQFRNFLTTQGKESEASKVGSSSRTRISSAQQHEQNIFRLFS
VGAVSNESPFYAELYFQEDGILTLATSSSNSLSFSGLEIEEGRWHHLAVVHSKPNALAGL
FQASVANVYLDGKLRHTGKLGYSPSPVGKSLQVIVGTPSTCARVSDLTWKTRSCYLFEEV
LSSGCIGFMYILGRGYKGLFQDADLLRFVPNQACGGGSMAILDSLDSDMTSSSNGQKFDG
SNRQGDSKADGSGIVWDLERLGNLSFQLPGKKLIFAFDGTCSEFIRASGSFSLLNLVDPL
SAAASPIGGIPRFGRLVGNVCICRQSVIGDTIRPVGGMTVVLALVEAAESRDMLHMALSL
LACALRQNPQNVKDMQTIRGYHLLALFLRPKMTLFDMQSLEIFFQIAACEALFSEPKKLE
SIQSNISVTPTETIFENSYEDLGLSRFRYESSSVGSHGDMDDFSVPKDSFSHLSELETDI
PVETSNCIVLSNVDMIEHVLLDWTLWVTSPVSIQIALLGFLENLVSMHWYRNHNLTILRR
INLVEHLLVTLQRGDVEVPVLEKLVVLLGCILEDGFLTSELENVVRFVIMTFNPPEVKSR
SSLLRESMGKHVIVRNMLLEMLIDLQVTIKAEELLELWHKIVSSKLITYFLDEAVHPTSM
RWIMTLLGVCLASSPNFSLKFRTSGGYQGLMRVLQNFYDSPDIYYILFCLIFGKPVYPRL
PEVRMLDFHALVPNDGSHVELKFIDLLDSVVGMARSTYDRLLMQSMLAHQSGNLSQISAS
LVAELVEGAEMTGELQGEALMHKTYAARLMGGEASAPAAATSVLRFMVDLAKMCPQFSAA
CRRADFVENCADLYFSCVRAAYAVKMAKQLSVKAEEKHINDGDDNGSQGTFSSLPHDQST
KTSISAGSFPQAQVSLSSEEMPLPANIVVNDKMVNILTPPPQDSSKSFQGVEDIKKQDDN
HVGPVSASSERDFPDLKGNANQVQATDSQSSASFHMIESPLLSEKSGLKVSFTPSPSPVV
ALASWLGSNYHESKSSTVGSPSLESYVSGTEVDASSERKSGSQGSSAAHAFFTVTPKLLL
ETDETGYGGGPCSAGASAVVMNYLERRLLRDDEEDEKKLDKSKWSANLDTFCWMIVDRVY
MGAFPHPSGVLRALEFLLSMLQLANKDGRVEEVTPSGKGFLSLGRATRQLDAYVHSILKN
TNRMVLYCFLPSFLITIGEEDLLSQLGLLVESKKRPSPNPAVDESGIDISTFLQLLVANR
RIIFCPSNLDTDLSCCLCVNLISLFLDQRKSVQNMSLDIVKYLLVHRRSALEDLLVTKPN
QGQKVDVLHGGFDKLLTGNLPEFFKWLESSDKIINKVLEQCAAVMWVQYIAGSAKFPGVR
IKGMEGRRKKEMGRKSRDMSKLDVKHWDQLNERRYALEVLRDAMSTELRVVRQNKYGWIL
HAESEWQTHLQQLVHERGIFPMRKSKRSEDPEWQLCPIEGPYRMRKKLERCKLKIDSIQN
VFDGKLELGEIELPKVKNEDGPVISDTDSEPAFLLSELYDEAFVKESDDFKDVASARNGW
NDDRASSTNEASLHSALDFGGKSSTASVPITDNTLAKSEAGSPRHSSSAKMDETKGEEEK
SENELNDDGEYLIRPYLEHLEKIRFRYNCERVVDLDKHDGIFLIGEFCLYVIENFYIDDD
GCICEKECEDELSVIDQALGVKKDASGSLDFQSKSSTSWTTAVKTGALGGRAVGGRAWAY
GGGAWGKEKMGTTGNLPHPWRMWKLNNVHEILKRDYQLRPVAIEIFSMDGCNDLLVFHKK
EREEVFKNLVAMNLSRNSMLDTTISGSAKQESNEGSRLFRLMAKSFSKRWQNGEISNFHY
LMHLNTLAGRGYSDLTQYPVFPWVLADYESESLDLSDPKTFRKLHKPMGCQTPEGEEEFR
KRYESWDDPEIPKFHYGSHYSSAGIVLFYLLRLPPFSAENQKLQGGQFDHADRLFNSIKD
TWLSAAGKGNTSDVKELIPEFFYMPEFLENRFSLDLGEKQSGEKVGDVFLPPWARGSVRE
FILKHREALESDYVSENLHHWIDLIFGYKQRGKAAEEAVNVFYHYTYEGNVDIDAVSDPA
LKASILAQINHFGQTPKQLFQKAHVKRRTDRKVPLHPLKHSMHLIPHETRKCPSSISQIT
TFHDKVLVAGANCFLKPRGYTKYITWGFPDRSLRFMSYDQDKLLSTHENLHESNQIQCAG
FSHDGRIVVTGAEDGLVCVWRVSKDGPRSSRRLRLEKALCAHTATVTCLRVSQPYMMIAS
GSDDCTVIIWDLSSMSFVRQLPDFPVPISAIYINDLTGEIVTAAGTVLAVWSINGDCLAV
ANTSQLPSDSVLSVTGSTSSDWLETAWYVTGHQSGAIKIWRMIHCTDPLSAESKTSSSNR
NGGLNLGDQVPEYKLILHKVLKFHKQPVTALYLPGDLKQLLSGDSAGQLLSWTLPDETLR
ASLKQASLKQAS
Download sequence
Identical sequences M4EX35
Bra033370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]