SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034268 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034268
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily TPR-like 0.000000000119
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra034268
Sequence length 105
Sequence
MDSKMGNFFDSIGSFFSGGDKIPWCDRDVILECEKEVKTATDGDSEDQKKESIMRLSWAL
VHSRQAEDIQRGIAMLEDGVIGIGITATAVGLIAGGIAAALARKK
Download sequence
Identical sequences M4EZM5
Bra034268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]