SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035067 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035067
Domain Number 1 Region: 71-164,192-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.51e-27
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  Bra035067
Domain Number - Region: 404-436
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000314
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra035067
Sequence length 454
Sequence
MLRFLIVALAIATVSVVTAQVPPEKQFRVVNNDEFGDYITEYDASYRFITSPNASFFTRP
FQLLFYNTTPSAYVLALRVGLRSEESLMRWIWDANRNNPVGENATLSLGRNGNLVLAESN
GQVKWQTNTANKGVTGFEILPNGNIVLHDKNGKFVWQSFDHPTDTLLTGQSLKVNGVNKL
VSRKSDMDGSDGPYSMVLDNKGLTMYVNKTGQPLVYGGWPNHDFRGTVTFAVRREFDNLT
EPSAYELLLEPAPQPTTTTNPGNNRRLLQSRPIGSGDGTLNLNKINYNGTISYLRLGSDG
SLKAFSWFDPATYLTWEESFSFFSTYFVRQCGLPSFCGDYGYCDRGMCVACPTPKGLLGW
SDQCSAPKTTQFCNGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVSDCKAKCDRDCKCL
GYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY
Download sequence
Identical sequences M4F1X0
XP_009106596.1.100322 Bra035067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]