SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035070 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035070
Domain Number 1 Region: 69-163,191-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-30
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 
Weak hits

Sequence:  Bra035070
Domain Number - Region: 380-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Pan module (APPLE domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra035070
Sequence length 441
Sequence
MKFSITLSLCFTLSIFLIGAQAKVPVDEQFRVVNDGGYTDYSPIEYNPDVRGFQPFNDNF
RLCFYNTTPNAYTLALRIGNRAQESTLRWVWEANRGSPVKENATLTFGEDGNLVLADADG
RLVWQTNTANKGAVGIKILENGNMVIYDANGKFIWQSFDSPTDTLLVGQSLKRNGRNKLV
SRLSRSVNTNGPYSLVMEDKKLVLYYTTSKTPKPIVYYDYEFFSKITQLQSMTFQAVEDS
DTTWGLHMEGVDSGSQFNVSTFLSRPKHNATLSFIRLESDGNVRVWSYSTLATATAWDVT
YTAFTNDDTDGNDECRIPEHCLNFGLCKKGQCNACPTDKGLLGWDETCKTPSLTSCDPKT
FHYFKIEGADSFMTKYNGGSSATEKACGDKCTSDCKCLGFFYNRKSSRCWMGYELKTMIR
TGDASLVAYVKAPNAIKKSVL
Download sequence
Identical sequences M4F1X3
Bra035070 XP_009106600.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]