SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035433 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035433
Domain Number 1 Region: 37-313
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-33
Family G proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 580-703
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-20
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra035433
Sequence length 1001
Sequence
MEAIDELSQLSDSMRQAAALLADEDPDESSSSSRRPATSLNVVALGNVGAGKSAVLNSLI
GHPVLPTGENGATRAPIIIDLSREESLSSKAIILQIDNKSQQVSASALRHSLQDRLSKGA
TGRGRDEIYLKLRTSTAPPLKLIDLPGLDQRIVDDSMIGEHAQHNDAILLVVVPASQASE
ISSSRALKIAKEYDSDSTRTVGIISKIDQAAENPKALAAVQALLSNQGPPKTTDIPWVAL
IGQSVAIASAQSGGSENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMK
LRLPNILSGLQGKSQIVQDELSRLGEQLVSSAEGTRAIALELCREFEDKFLLHLAGGEGS
GWKVVASFEGNFPNRIKQLPLDRYFDLNNVKRIVLEADGYQPYLISPEKGWRSLIKIVLE
LAKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMV
VALVDMERAFVPPQHFIRLVQRRMERQRREDELKGRSSRKGQDAEQSLLNRASSPQPEGS
STGGSLKSLKDKFLPQDKDKDKDKETPEVSGLKTAGPEGEITAGYLLKKSAKTNGWSRRW
FVLNEKTGKLGYTKKQEERNFRGTVTLEECSIEEISDDDGEKSKSSKDKKSNGPDSKGPG
LVFKITCRVPYKTVLKAHNALVLKAESMVDKNEWINKLQKVIQARGGQVGGASMRQSFSE
GSLDKMVRKPVDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKSKEDMLNQLY
SSISAIGNERIESLIQEDQNVKRKRDRYEKQSSLLSKLTRQLSIHDNRAAAASSWSDSGT
ESSPKTNGGSTGEDWMNAFNAAASGQDSLKRYGSGGHSRRYSDPAQNGEDDSSGSGGSNR
RTTPNRLPPAPPQSGGSSYRGPQASGEHNLSPVGLTSPSPGGLSGPCTSSVKISLANISD
VSIHTVLSIVKYIPGTGDEARVNRLTIPLTEHFNFKGCTVV
Download sequence
Identical sequences M4F2Y3
Bra035433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]