SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035455 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035455
Domain Number 1 Region: 1960-2246
Classification Level Classification E-value
Superfamily BEACH domain 4.05e-122
Family BEACH domain 0.0000000148
Further Details:      
 
Domain Number 2 Region: 2351-2613
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-43
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 457-641
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.2e-24
Family Clostridium neurotoxins, the second last domain 0.038
Further Details:      
 
Domain Number 4 Region: 1785-1827,1870-1933
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000338
Family PreBEACH PH-like domain 0.0074
Further Details:      
 
Domain Number 5 Region: 124-233,263-397,763-889,917-1025,1053-1243
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000155
Family PBS lyase HEAT-like repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra035455
Sequence length 2624
Sequence
MESPATASHSVRISISPMLVVVDCLRIDKNPSVSVLLDALEQSVSTPSIANGLSQRLLRS
LQLSNENKLSFKALNGPCRVLRLACTQARESRKSLCVDPLLESSDDSGVLVDSPHNKSHS
EDCSFECVETCIGIFSEFFSSTDDAKVYVLRSSVCVDCLFELFWEKAVRNNVMKHIIDLM
KITPLCDEDKTAKLQVCSKYLETFTQVKERENDFVDLSVDLLAGMRDLIQTDSRYYQALF
RDGECFLHIVSLLNGNFDEANGEKLVLNVLQTLTSLLANNDASKFAFKALAGKGYQTLQS
LLLDFFQWQPTQRLLDALLDMLVDGKFDDKGSALIKNEDVIILYLNVLQKSSESLQCYGL
NLFQQLLRDSISNRASCVRAGMLNLLLDWFSLEDAESVILKITQLTRTIGGHSISGKDIR
KIFALLRSERVGNQQKYRSLLLACLLSMLNEKGPTGFFDMNGVDSGIVIKTPVQWPVNKG
FSFCCWLRVESFRGDGKMGIFSFMSKNGKGCFAAVGNDGLSYVSLNLKRQCVNVHTNLVS
KKWHFICVSHSIGRAFWGGSLLRCYVDGELVSSERCSYPKVTDVLTSCFIGTSITLPHIQ
DNEGLESIRDVFPFFGQIGPIYLFNDALSSDQVQAIYSLGPSYMYAFLENEMTGPFSDNP
FPSAILDGKDGLAPKVSFGLNAQASDGRRLFNVSRVSDHLQDRLVFEADIMVGTQLCSRR
LLQQIIYCVGGISVFFPLITQTDRCESEALQEEASSMPAPEERMTAEVIELIASVLDENP
GNQQQMHLLSGFPILGFLLQSIQPKQLNLETLSSMKHLFNVISSSGFAEQLVEDAISSIF
LNPHIWIRATYNVQRELYMFLIQQLDNDPRLLGSLCRLPRVIDIVWNFYWESERYRSAKG
SKPLLQPARTIAERPSRDEIHKIRLLLLSLVFALSFIPTFHPYFRQNITSGDVKALIAFF
ETCQDVACIEDVLHMVIRAISQTSVLASFLEQVNLIGGCHIFVNLLQRDYEPIRLLSLQF
LGRLLYDVPSEKKGPRFFTLPVGRTKFLSQGHKKIGGRTQPIFVAMSDRLFQYPQTDNLR
ATLFDVLLGGASPKQVLQKYNQVDKQRSKASNSHFFLPQIFVFIFKFLSGCKDGSARIKI
ISDILDLLDSNPMNVEALMEFGWSAWLSASVTLDVIKDYRSELLNHDDLALNEQHFVRGL
FCVVLCHYILSVKGGWQQLEETVNFILLHCEHNDAPYRSFLRDLYEDLIQRLVELSSEDN
IFLSHPCRDNVLYLLRLVDEMLVREFGSRLLFPANSADFSEDLLQLANREDHSLGLDENF
QRLLTEETSRNTESQHSCTTITELMTNERWWNLYDNLWRIICDINGRGPMKMSPKSLATG
PSIGQRARGLVESLNVPAAEMAAVVVSGGIGNALSGKINKNVDKAMLLRSEKCPRIVFRL
VTLYLCMSSLEKATRCVQQVTSLLPSFLSADDEQSKSRLHLFIGCLLYVRSQYGKLDDGA
RFHVISHLIRETVSCGKSILATSGMSKDDSSESGGIFKEVGSIQNLIHKDRVLAAVTDET
TYMKTLLSDRTRKVKALGERNNEASSLESNSKKPFDDELQSGLKTVLTWDENRRVAVQLS
HEEQQQNVTEKWIHMLRSLMDERGPWSATPFPNNIVNHWKLDRTEDSWRRRPKLRRNYHF
DERLCHPPSTSTATENETTNVINESKSGVIHLPEQMKRFLLKGIRRITDEGGSESCENDN
SQSEQNLLDTSAEIQFSELVRSSSDLKDVVQEKVDASSLEVETSEVLTSVPCVLITPKRK
LAGCLAVMKNVLHFSGEFLVEGTGGSSVFKNFSTAKGGDVTKTDSKQNLVKWSSPYERET
SLDLESEKNNQKPLKKFKRHRRWKIGKVKSVHWTRYLLQYTAVVIFFQESVPPVFLNFAS
PKNAKEVGMLIVSTRNEFLFPKSVPRDRTAVISFVDRRVAMEMAEAARDRWRRREITNFE
YLMILNTLAGRSYNDLTQYPVFPWVVADYSSETLDFSKASTFRDLSKPVGALDSRRFEVF
EDRYHSFSDPDIPSFYYGSHYSSMGSVLYYLLRLEPFTSLHRSLQGGKFDHADRLFQSIE
GTYRNCLSNTSDVKELIPEFFYMPEFLVNSNSYHLGVKQDGEPLGDICLPPWAKGSPEMF
IARNREALESEYVSSHLHEWIDLIFGHKQRGKPAVEAANIFYYLTYEGAVDVENMEDELQ
ISAVEDQIANFGQTPIQIFRKKHPRRGPPIPIAHPLYFAPASINLTSILPATTNPPSSVL
YVGVLDSNIVLVNQGLTLSVKIWLTTQLHSGGNFTFSSSQDPYFGVGSDVLSPRNIGSPL
ADNVELGSQCFATMQTPQENFLVSCGNWENSFHVISLTDGRVVQSIRHHKDVVSCVAVTA
DSSILATGSYDTTVMVWDILRMKTPEKRVKNMHAEALRRDIVLADAPSHILCGHDDIITC
LYVSTDLDIVISGSKDGTCVFHTLREGRYIRSLKHPSGSAVSKLAASHHGRIVLYGDDDL
SLHLYSINGKHLASSESNGRINCLELSKCGEFLVTAGDQGQIVVRSMNTLEVVRRYSGAG
KIITSLTVTQEECFLAGTKDGALLVYSIENPQHRKPNPIWSIKS
Download sequence
Identical sequences M4F305
Bra035455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]