SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038497 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra038497
Domain Number 1 Region: 302-411
Classification Level Classification E-value
Superfamily PH domain-like 0.00000268
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra038497
Sequence length 431
Sequence
MDQERTLNLFPYGLQEVAEVEEIEEDNDNESMTLSSVPENETSECSSSPETYPPIPPRPK
TPREPMEFLCRSWSSSTSDKSNKQLNKTHTLSELAGVTSPAPAPLPPPLRTENPASVVHA
RRTSAIGKWFHQRDFVGGKVSSISKRDKSRYENAHLHTAVSIASLATAIAAVTASGNQDG
ALMESKMISALASASELLASHCVELAELSGAGHDRVVSAVRSAVDVRGPGDLLTLTAAAA
TALRGEAALRTRLPKEAKNNAAISPCERALPETHDCSSELDSASTTTEEQQTSAQGVDES
DLTCNGELMQCTRNGVLRWKHMKVYINKKSQVVVEIKSKHVRGAFSMKSKGIVNDVCETV
SGLQSVKETENAEEKELYFGISTGKGLTKFKCKSKADKQTWVDSIRNLLHRVTAVETINT
SLETTNIGDST
Download sequence
Identical sequences M4FBN1
Bra038497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]