SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038635 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra038635
Domain Number 1 Region: 49-139
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-20
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 
Weak hits

Sequence:  Bra038635
Domain Number - Region: 299-340
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra038635
Sequence length 381
Sequence
MLSSESLTISSNRTLVSPGGVFELGFFKPSGRSRWYLGIWYKKVPRRTYAWVANRDNPLP
NCSGTLKISGNNLVLLVIAELLPNGNFVMRYSNNNNSSGFLWQSFDFPTDTLLPDMKLGY
DLKTGRNRFLTSWRSYDDPSSGNTTYKLDIRRGLPEFILINQRVEIQRSGPWNGIEFSGI
PEVQGLNYMVYNYTENNKEIAYSFHMTNQSIHSRLTVSDYTLNRFTWIPPSQGWSLFWAL
PTDVCDSLYLCGSYSYCDLTTSPNCNCIRGFVPKNTQQWDLKDGSQGCVRRTRLSGSGDG
FLRLNNMKLPDTKTATVDRTIDVKKCEERCLSDCNCTSFAIADVRNGGLGCVFWTGELVE
IRKYAVGGQDLYVRLNAADLG
Download sequence
Identical sequences M4FC19
Bra038635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]