SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530280467|ref|YP_007982538.2| from Helicobacter pylori UM037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530280467|ref|YP_007982538.2|
Domain Number 1 Region: 60-134
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000733
Family Sec7 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530280467|ref|YP_007982538.2|
Sequence length 134
Comment hypothetical protein K750_05945 [Helicobacter pylori UM037]
Sequence
MMRVVVFDASGSLEAFDYRGVLIHTQEIQANEKVKLPFTQKNFFKFNGVSFGVCEGVGDL
DYKDYPKNLNFNALSIETIENYLLNAKEPQNTQQKALLTDFLEVYNKNIEKGFIYLKPRF
FLEKEKQLIERILK
Download sequence
Identical sequences gi|530280467|ref|YP_007982538.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]