SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434374660|ref|YP_006609304.1| from Bacillus thuringiensis HD-789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434374660|ref|YP_006609304.1|
Domain Number 1 Region: 19-69
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000209
Family BAS1536-like 0.0000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434374660|ref|YP_006609304.1|
Sequence length 72
Comment stage 0 sporulation regulatory protein [Bacillus thuringiensis HD-789]
Sequence
MYYNFTSNIMGKGSFSIEMEMGQLQNKIENKKKELIQLVARHGLDHDKVLLFSRDLDILI
NKFMNGKDKVHK
Download sequence
Identical sequences A0A0Q0QYK9 A0A0Q9GDX3 A0A0Q9GXC2 A0A160L8T4 A0A242Y2N1 A0A243B4A3 A0A243MLL5 A0A2B9FKW9 A0A2H3QSW0 B7IQ86 J3WYV4 J7WB24 J8F8F0 Q3EUQ5 R8C760 R8IH46 R8S9Q3 R8YFD8
405531.BCG9842_B3656 gi|434374660|ref|YP_006609304.1| gi|218896656|ref|YP_002445067.1| WP_000291690.1.100497 WP_000291690.1.101838 WP_000291690.1.12935 WP_000291690.1.13269 WP_000291690.1.22084 WP_000291690.1.26459 WP_000291690.1.27446 WP_000291690.1.28599 WP_000291690.1.34537 WP_000291690.1.3546 WP_000291690.1.35769 WP_000291690.1.36279 WP_000291690.1.38325 WP_000291690.1.4355 WP_000291690.1.48759 WP_000291690.1.50042 WP_000291690.1.52284 WP_000291690.1.58712 WP_000291690.1.59384 WP_000291690.1.60526 WP_000291690.1.61799 WP_000291690.1.6241 WP_000291690.1.64421 WP_000291690.1.70667 WP_000291690.1.83666 WP_000291690.1.87649 WP_000291690.1.87705 WP_000291690.1.89145 WP_000291690.1.92555 WP_000291690.1.9703 WP_000291690.1.97821 WP_000291690.1.97830 WP_000291690.1.98315 gi|402561286|ref|YP_006604010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]