SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|442323359|ref|YP_007363380.1| from Myxococcus stipitatus DSM 14675

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442323359|ref|YP_007363380.1|
Domain Number 1 Region: 152-401
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-67
Family Subtilases 0.00000742
Further Details:      
 
Domain Number 2 Region: 64-134
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000000102
Family Subtilase propeptides/inhibitors 0.0022
Further Details:      
 
Domain Number 3 Region: 427-461
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000017
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|442323359|ref|YP_007363380.1|
Sequence length 462
Comment alkaline serine exoprotease A precursor [Myxococcus stipitatus DSM 14675]
Sequence
MRPHLSLAHRARAVAFRTLSLLGALALGGSACGERPSSGEPAAAAVDTVKLARLTRAPES
LRVPGEYVVVFAQGLSGGALTAAADTITRAGGTNTLLHRYSLIPGFTARLDDAQLDRLRR
DPGVAYIEENQHVFLKSAVPSPSDGIDRVDQRQGRDGQYNDYENTGAGVHVYVLDTGLNT
EHSEFTGRVGSSESFVFDGFGVEDCHGHGTHVASTAVGTQYGMAKQATLHPVRILNCIGR
ATWGTIIAGLEFVRMDCPRQDGPCVANLSLSGEFFQPVNQAAAALVDAGIPVVVAAGNSN
IDACLESPGSEPKVINVGAVDDNDKRALFSNWGTCVDLFAPGVSILGAWAGDAVATNIDD
GTSMAAPHVTGAVAQYLESHRTATPAQVTVNLKGAATLGCVDDLMGSPNSLLFSDLSQGN
YLCVADPNSCKGLCGGAATGCFCDPTCLEFNDCCPDFQQVCQ
Download sequence
Identical sequences L7UFH6
gi|442323359|ref|YP_007363380.1| WP_015351950.1.99865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]