SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000255 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000255
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000255   Gene: ENSCJAG00000000154   Transcript: ENSCJAT00000000275
Sequence length 178
Comment pep:known chromosome:C_jacchus3.2.1:7:40622872:40624254:1 gene:ENSCJAG00000000154 transcript:ENSCJAT00000000275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKRRARINVSLEQLKSLLEKHYSHQIQKRKLEKADILELSVKYMKSLQNSLQGVWPVP
SGAEHPSGFRSCLPGVSQFLRLGDEGGGGLRCPLVPERAIGSTMDSAGPGQEAPGLCGPC
TPAVWAPTPAASGPRSPPLLLLPPGSLPGSSSSVLPPQPASSRCAESPGLGLRVWRPW
Download sequence
Identical sequences F7GN68
ENSCJAP00000000255 NP_001257646.1.60252 ENSCJAP00000000255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]