SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000411 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000411
Domain Number 1 Region: 171-291
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000419
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 2-72,108-162
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000227
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000411   Gene: ENSCJAG00000000247   Transcript: ENSCJAT00000000444
Sequence length 292
Comment pep:known chromosome:C_jacchus3.2.1:16:39010239:39132032:1 gene:ENSCJAG00000000247 transcript:ENSCJAT00000000444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPIHRTPYEHKTVWKFLKTVPDLASQLNDEHLKTLSKTAFSETWLKGSTVVANDGFYII
LKGLARSQTKVYYNLMEGSDSQVSFIPQSFPSLILGEKFKKSTLAEMCLPSYDSMLSKWS
TFGTLEITPETESATRAFSVVTEDDCEILKISAKEYAKIKEEKLKLENMQKLKLIRMCPY
YEEWPALSVVELTALLKWKKFPPGHVIVKSGNIISFVGYINSGCCNIYRNIIGFVKLQSN
KVKKARKLVYMGKLKEKESFGEISVLLQVPFTCTIITEKEVEMAIIEDKDLF
Download sequence
Identical sequences F7G1K5
ENSCJAP00000000411 ENSCJAP00000000411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]