SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000427 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000427
Domain Number 1 Region: 450-640
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-44
Family cAMP-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 217-443
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-29
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000427   Gene: ENSCJAG00000000249   Transcript: ENSCJAT00000000461
Sequence length 808
Comment pep:novel chromosome:C_jacchus3.2.1:16:38385772:38545258:-1 gene:ENSCJAG00000000249 transcript:ENSCJAT00000000461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTKVNKVKPIGENNENEQSSHQNKQGSQPNNQPQQTTTQEENKSEEKSLKTKSTPD
TSEEPHTNIQDKLSKKNSSGNLTTNPDPQNAAEPTRTMPEEKEVDPGKEGPNSPQSKPPE
PPVINEYADAQLHNLVKRMRQRTAIYKKKLVEGDLSSPEASPKTAKPTAVPAVKESDKPT
EEHYYRLLCFKVKKMPLTEYLKQLKLPESIDSYTDQLYLLWLLLVTLAYNWNCWFIPLRL
VFPYQTPDNIHYWLIVDIICDIIYLYDILLIQPRIQFIRGGDIIVDSNELRKHYRSSTKF
QLDVASIIPFDVCYLFFGFNPIFRANRMLKYTSFFEFNHHLESRMDKAYIYRVIRTTGYL
LFILHINACVYYWASNYEGIGSTRWVYDGEGNKYLRCYYWAVRTLITIGGLPEPQTLFEI
VFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVR
TWYEYTWASQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRL
KSILYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGG
GNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEVTPPRK
NLAFLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQTAQEKENSEGGEEKERKENEDK
QKENEDKGKENEDKGKENEDKGREPAEKPLNRPEYTASPVAVEEEPQSVRRTVLPRGTSR
QSLIISMAPSAEGGEEVLTIEVKEKAKQ
Download sequence
Identical sequences F7G1E6
ENSCJAP00000000427 ENSCJAP00000000428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]