SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000792 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000792
Domain Number 1 Region: 198-363,395-457
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-38
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 460-653
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.22e-31
Family cAMP-binding domain 0.00076
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000792   Gene: ENSCJAG00000000460   Transcript: ENSCJAT00000000847
Sequence length 993
Comment pep:known chromosome:C_jacchus3.2.1:5:113856935:113879984:-1 gene:ENSCJAG00000000460 transcript:ENSCJAT00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDSNFLLANAQGPRGFPIVYCSDGFCELTGYSRTEVMQKTCSCRFLYGPETSEPALQRLQ
KALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLLLFSFKDITQSGSPALGPR
GGHRDSNHEKSLGRRGASSKFRSARRQSSTVLRRLTGHFSRRGQGGMKSNNNVFEPKPSV
PEYKVASVGGSRCLLLHYSVPKAIWDGLILLATFYVAVTVPYNVCFLGDDDTPITSRHTL
VSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFIDLIAALPFDLLYI
FNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACIWYVIG
RREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGPSRRSAYIAALYFTLSSLTSVGFGN
VCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRL
PRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGC
LRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIP
EPGQETGSGADPSFVLKTSADVKALTYCGLQQLSSQGLAEVLRLYPEYGAALRASLPRDL
TFNLRQGSDTSGLSRFSRSPRLTQPCSESLGSSSDKTLTSITEAESGTEPGGGPRPRRPL
LLPNLSPARPRGSLVSLLGEELPPFSALVSSSSLSPSPSPALAGQGHSPSPHGPPRCSAA
WKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEAPSFRFSRRPELPRPRSQAPPTGTR
PSSELASEAEEVKEKVCRLNQEICRLNQEVSQLSRELRHIMGLLQARLGPPGQAAGPAWT
PEPPCPHLRPPCLSPCASRSPPSLQDTTRAEVHPPASMGTMETGTAPLDSRPSILLPYPA
EPDPLGPSPMPEASPSTPSLMRHSFQSRSDTFH
Download sequence
Identical sequences F6RFP5
ENSCJAP00000000792 ENSCJAP00000000792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]