SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000969 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000969
Domain Number 1 Region: 16-96
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.2e-38
Family PB1 domain 0.0000867
Further Details:      
 
Domain Number 2 Region: 133-251
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-23
Family PDZ domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000969   Gene: ENSCJAG00000000559   Transcript: ENSCJAT00000001029
Sequence length 372
Comment pep:known chromosome:C_jacchus3.2.1:5:44654665:44674205:1 gene:ENSCJAG00000000559 transcript:ENSCJAT00000001029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSHRHAAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLSNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIERSFEPEDEDSEEDDIIIED
NGVPQQIPKAVANTESLESLTQIELSLESGQNGFIPSNEVSIASIASSTNTEFETHAPDQ
KLLEEDGTIITL
Download sequence
Identical sequences F6RQ62
ENSCJAP00000000969 XP_002747714.1.60252 ENSCJAP00000000969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]