SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000987 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000987
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-76
Family BAR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000012
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 4.21e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 818-873
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000433
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000987   Gene: ENSCJAG00000000566   Transcript: ENSCJAT00000001048
Sequence length 874
Comment pep:novel chromosome:C_jacchus3.2.1:11:36286256:36375396:-1 gene:ENSCJAG00000000566 transcript:ENSCJAT00000001048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKF
SQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFR
KEQIGAAKDGKKKFDKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLE
YVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFE
STRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTM
SVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEA
NRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG
VNSKVQKLMNTIFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIA
VKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL
MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLS
TGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSG
GIPWIATPSSSNGQKSLGLWTTSPESSSREDAAKTDAESDSQSVASVTSPGDVSPPIDLV
KKGPYGLSELKRASAASLRSISAAEGNKSYSGSIQSLTSVGSKETPKVSPNPDLPPKMCR
RLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKPVSSGRQAKAMYSCKAEHSHELSFPQG
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences F6R438
ENSCJAP00000000997 XP_002754692.1.60252 ENSCJAP00000000987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]