SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001453 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001453
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.61e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 86-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000104
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001453   Gene: ENSCJAG00000000851   Transcript: ENSCJAT00000001542
Sequence length 146
Comment pep:novel chromosome:C_jacchus3.2.1:11:47939957:47940728:-1 gene:ENSCJAG00000000851 transcript:ENSCJAT00000001542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGFLKAFQRTVTCPICTNYFIDPVTLDCGHSFCRPCLYLSWQDIQVLAQCSKCRKTTQ
QRNLKTNINLKNLASLARKASLWQFLRSEEQMCEIHRQTKKMFCEGDKSLLCLLCSDSQE
HRDHRHCSIEWAAEQRWEKLLKKMQS
Download sequence
Identical sequences F6WKW0
ENSCJAP00000001453 ENSCJAP00000001453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]