SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001767 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001767
Domain Number 1 Region: 294-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000168
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 122-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000275
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-79
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000089
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001767   Gene: ENSCJAG00000001029   Transcript: ENSCJAT00000001876
Sequence length 824
Comment pep:known chromosome:C_jacchus3.2.1:8:38802576:38846659:-1 gene:ENSCJAG00000001029 transcript:ENSCJAT00000001876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSLAERNEGQDNCRAANFREGLYLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQRVEAEAPGLPQPVVCYNADQVPPENSPFMERCFICRLRCLLDNSSGFLAMNF
QGRLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIG
CDAKGRIVLGYTEAELCTRGSGYQFLHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNR
WAWVQSNARLLYKNGRPDYIIATQRPLTDEEGNEHLRKRNTKLPFMFTTGEAVLYEVTNP
FPAIMDPLPLRTKNGTSGKDSATKSTLNKECLNPSSLLAAMMQQDESIYLYPASSTSCTA
PFDNNFFNESMNECRNWQDNTASMGNDTILKHEQIDQSQDVNSFAGGHPGLFQDSKNTDL
YSIMKNLGIDLEDIKHMQNEKFFRNDFSGEVDFRDIDLTDEILTYIQDSLNKSAFVPSDY
QQQQSLALNSSCMLCQKMKHMQVNGMFANWNSTQFVPFSCPQQDLQQYNVFSDVHGINQE
FPYKSEIDPMPYTQNFISCNQSVLPQHSKCTELDYPMGSFEPSPYSTTSSLEQFVTCLQV
PENQHHGLNPQSAIVTPQTCYAGSVSMYQCQPEPQHTHVGQMQYSPVLPGQQAFLNKFQN
GVLNETYPAELNNINNTQTTTHLQPLHHPSEATPFPDLTSSGFL
Download sequence
Identical sequences F6X4G6
ENSCJAP00000001767 ENSCJAP00000001759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]