SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001881 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001881
Domain Number 1 Region: 36-117
Classification Level Classification E-value
Superfamily RING/U-box 2.01e-17
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 2 Region: 205-259
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000642
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 109-178
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000197
Family IBR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001881   Gene: ENSCJAG00000001085   Transcript: ENSCJAT00000001994
Sequence length 642
Comment pep:novel chromosome:C_jacchus3.2.1:7:67173701:67202672:-1 gene:ENSCJAG00000001085 transcript:ENSCJAT00000001994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTLPAEPAAEAETEAAAAAEPEFDDEEAAEGGGSGSEEVECPLCLMRLPPEQAPRLLSCP
HRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLA
SDPDCRWCPAPDCGCYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQ
RAQSLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWL
CMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISLIAGIAIPAMVIGIP
VYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGIGVPIMLAYVYGVVP
ISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGESSIEGLTSVLSTSG
SPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQADVQKEIFPKDTASL
GAISDNASTRAMAGSIISSYNPQDRYVNSQMSRRGCIFWLGTRSSEVECLMVGLYRLAEL
NQQKGSNYSSPSHLXPADTKLEQKDCCSNWDISWPRLESSDTQSDDVPDITSDECGSPRF
HTAACPSTPRAQGVPSPSAHMNLSALAEGQTVLKPEGTEARV
Download sequence
Identical sequences F7AWC0
ENSCJAP00000001881 ENSCJAP00000001881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]