SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001883 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001883
Domain Number 1 Region: 217-330
Classification Level Classification E-value
Superfamily Translation proteins 6.83e-31
Family Elongation factors 0.00009
Further Details:      
 
Domain Number 2 Region: 29-79,115-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.1e-20
Family G proteins 0.0000307
Further Details:      
 
Domain Number 3 Region: 331-405
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000000000000249
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001883   Gene: ENSCJAG00000001099   Transcript: ENSCJAT00000001996
Sequence length 407
Comment pep:novel chromosome:C_jacchus3.2.1:17:25523136:25524417:1 gene:ENSCJAG00000001099 transcript:ENSCJAT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWRHLSRQDLATLDVTKLTSLSQEVTNREATINIGTTGHVAHEKSTVVVKAISGVRAVRF
KRNTLIKLGYTNDKIYKLDDPRCPRSECYRPCGSCRSDEFPTDIPGTKGNLRLVRHFSFA
DCPGHDILMATMPNGAAVMVAALLLIGGNESCPQPQTSEQLTAIENMKLKHILILQNKID
LIKKKSQAKEQYEHILAFVQGTVAEGAPMIPISAVQNFTSEPRVIVIRSFDVNKPGCEVD
DLKGWGAGGSILKGVLKVGQEIEVRPGIVSKDSEGKHVCKTIFSRIVSLFAKHNDLQYAA
PGSLIGVAMKIDPTLCQAERMVGQVLCAVGTLPEIVTELDVSHFPLKQFLGIHTEGDKKV
AKVQKLSKNEVLMVSIGSLSTGGRVSAVKVELGKIVLTNPVCTEVGK
Download sequence
Identical sequences F7AW79
ENSCJAP00000001883 ENSCJAP00000001883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]