SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002065 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002065
Domain Number 1 Region: 82-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000114
Family HLH, helix-loop-helix DNA-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002065   Gene: ENSCJAG00000001198   Transcript: ENSCJAT00000002183
Sequence length 213
Comment pep:novel chromosome:C_jacchus3.2.1:14:81289245:81293401:-1 gene:ENSCJAG00000001198 transcript:ENSCJAT00000002183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQREARGPPAMPGVGDSQTQVKARLLPGTDRKRSRHSRTRQDPWEERSWSNQKWSRAGP
GPRGARSGSLALGRSEASPENAARERSRVRTLRQAFSALQAALAVPPDTKLSKLDVLVLA
TSYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTASTP
TQRTRDAEVGSQVAGEAGALLPTTALSPALVDK
Download sequence
Identical sequences F7I080
ENSCJAP00000002065 ENSCJAP00000002065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]