SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002070 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002070
Domain Number 1 Region: 140-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.56e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002070   Gene: ENSCJAG00000001181   Transcript: ENSCJAT00000002188
Sequence length 381
Comment pep:novel chromosome:C_jacchus3.2.1:9:65178142:65189271:-1 gene:ENSCJAG00000001181 transcript:ENSCJAT00000002188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSLERPEKAAGKSEFRNQKLKPDNQDESELLTVPDGWKEPAFSKEDNPRGLLEESSF
ATLFPKYREAYLKECWPLVQKALIEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLI
RLLARSVSFEQKAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLT
NCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSW
ERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKM
EAIKAKQAEAISKRQEERNKAFIPPKEKPVVKPKKASTETKIDVASIKEKVKKAKNKKLG
ALTAEEIALKMEAGEKKRKKK
Download sequence
Identical sequences F7HXY2
ENSCJAP00000002073 ENSCJAP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]