SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002126 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002126
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.75e-43
Family Dual specificity phosphatase-like 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002126   Gene: ENSCJAG00000001221   Transcript: ENSCJAT00000002244
Sequence length 220
Comment pep:known chromosome:C_jacchus3.2.1:12:48973623:48995959:1 gene:ENSCJAG00000001221 transcript:ENSCJAT00000002244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSREVKTSLKNAYSSVKRPSLKVEEEGDEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYHDMDIQYHGVEAEDLPTFD
LSVFFYPAAAFIDRALRDDHSKILVHCVMGRSRSATLVLAYLMIHEDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAQRQDGEEADGRGL
Download sequence
Identical sequences F7IJ24
XP_009007927.1.60252 ENSCJAP00000002126 ENSCJAP00000002126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]