SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002292 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002292
Domain Number 1 Region: 222-289
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-20
Family RING finger domain, C3HC4 0.0038
Further Details:      
 
Domain Number 2 Region: 94-135
Classification Level Classification E-value
Superfamily PA domain 0.0000085
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002292   Gene: ENSCJAG00000001297   Transcript: ENSCJAT00000002420
Sequence length 381
Comment pep:known chromosome:C_jacchus3.2.1:17:27232092:27419148:-1 gene:ENSCJAG00000001297 transcript:ENSCJAT00000002420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLP
AEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAI
VHNVDSDDLISMGSNDIEILKKIDIPSVFIGESSANSLKDEFTYDKGGHLILVPEFSLPL
EYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVC
AICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQ
EENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINE
HDVVVQLQSNGERDYNIANTV
Download sequence
Identical sequences F7HBJ4
ENSCJAP00000002292 ENSCJAP00000044695 ENSCJAP00000002292 XP_002759543.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]