SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002832 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002832
Domain Number 1 Region: 315-374
Classification Level Classification E-value
Superfamily RING/U-box 0.000000648
Family U-box 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002832   Gene: ENSCJAG00000001587   Transcript: ENSCJAT00000002991
Sequence length 376
Comment pep:novel chromosome:C_jacchus3.2.1:3:189557051:189585030:-1 gene:ENSCJAG00000001587 transcript:ENSCJAT00000002991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVPYETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVL
KRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNT
AVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLR
IQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQAMGMLAFPPDTHISPYKPCLSQV
KSALTLQRVEIRAFTLQRVDIRVKSALTLQRVDIRVKSALQCYKEDGSSKSPDCPVCSRS
LNKLAQPLPMAHCANSRLVCKISGDVMNENNPPRMLPNGYVYGYNSLLSIRQDDKVVCPR
TKEVFHFSQAEKVYIM
Download sequence
Identical sequences F7IBG6
ENSCJAP00000002832 ENSCJAP00000002832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]