SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003052 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003052
Domain Number 1 Region: 125-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000034
Family cAMP-binding domain 0.071
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003052
Domain Number - Region: 61-117
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.00353
Family Taf5 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003052   Gene: ENSCJAG00000001700   Transcript: ENSCJAT00000003221
Sequence length 291
Comment pep:known chromosome:C_jacchus3.2.1:4:104551769:104574499:-1 gene:ENSCJAG00000001700 transcript:ENSCJAT00000003221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG
FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG
ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPFQF
LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA
DKLYALNDRVYIGKRYHYDIRLPNFYQMSSPEIRRSPLTQHFRNSRPYCEI
Download sequence
Identical sequences A0A2K5D9V8 F7GHY4
ENSCJAP00000003052 ENSCJAP00000003052 XP_002746897.1.60252 XP_012293913.1.9421 XP_012293914.1.9421 XP_021526185.1.9421 XP_021526186.1.9421 XP_021526187.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]