SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003427 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003427
Domain Number 1 Region: 181-261
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 92-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 463-511
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000146
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003427   Gene: ENSCJAG00000001902   Transcript: ENSCJAT00000003617
Sequence length 516
Comment pep:novel chromosome:C_jacchus3.2.1:13:89115105:89136414:-1 gene:ENSCJAG00000001902 transcript:ENSCJAT00000003617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEVADEEVRLSLLLLSPFAATASQNQPIPSVSLRTVLLPATGFDSREAAVAAAGVLYGGY
DAQGMMAVMLSHALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIKALRAKTN
TYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNL
PGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRA
REEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSRARMISNYR
NDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLTVDSPAFDSLP
TSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSD
PPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEVIAALVPC
GHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences F7GZX8
ENSCJAP00000003427 ENSCJAP00000003427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]