SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003491 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003491
Domain Number 1 Region: 1-171,206-221
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-51
Family Ribonuclease PH domain 1-like 0.000000043
Further Details:      
 
Domain Number 2 Region: 192-282
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.98e-25
Family Ribonuclease PH domain 2-like 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003491   Gene: ENSCJAG00000001928   Transcript: ENSCJAT00000003681
Sequence length 291
Comment pep:known chromosome:C_jacchus3.2.1:15:20647290:20682322:1 gene:ENSCJAG00000001928 transcript:ENSCJAT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVALSEAEKVYIMHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILV
GVKAEMGMPKLEKPNEGYLEFFVDCSANATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
LKTLCISAREHCWVLYVDVLLLECDGNLFDAISIAVKAALFNTRIPRVRVLEDEEGSKDI
ELSDDPYDCIRLSVENVPCIVTLCKIGYQHVVDATLQEEACSLASLLVSVTSKGVVTCLR
KVGKGSLDPESIFEMMETSKRVGKVLHASLQSILHKEESLGPRRQKVGFLG
Download sequence
Identical sequences F7GH28
ENSCJAP00000003491 XP_002807638.2.60252 ENSCJAP00000003491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]