SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003623 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003623
Domain Number 1 Region: 483-742
Classification Level Classification E-value
Superfamily NHL repeat 4.97e-47
Family NHL repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 333-429
Classification Level Classification E-value
Superfamily E set domains 1.6e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 109-171
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 18-92
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000042
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003623   Gene: ENSCJAG00000002004   Transcript: ENSCJAT00000003816
Sequence length 744
Comment pep:known chromosome:C_jacchus3.2.1:3:39157953:39363652:-1 gene:ENSCJAG00000002004 transcript:ENSCJAT00000003816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC
PVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNVEESSILETVTAVAAGKPLSCPN
HDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEID
SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGVKHKVLQSQ
LDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD
FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT
GNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK
VIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKG
RNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA
VHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF
IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFG
SNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLA
LTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences F7H9X2
ENSCJAP00000003623 ENSCJAP00000003623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]