SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003807 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003807
Domain Number 1 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-45
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-19
Family Flavin-binding PAS domain 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003807   Gene: ENSCJAG00000019748   Transcript: ENSCJAT00000004011
Sequence length 996
Comment pep:known chromosome:C_jacchus3.2.1:5:82244834:82270934:1 gene:ENSCJAG00000019748 transcript:ENSCJAT00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAEALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAELLAKRSSRSLSQRLLSQSFLGSEGSHSRPGGPGLGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
VPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIIINFRTTYVNNNDEVVSHPRRIVVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLREAAGG
LHSSPQQAPGSQDHQGFFLKDNQSGEFPHELRPQLPSQGYSLLGPGSQNSLGAGPCAPGH
PDAAPPLSISDASAFWPELLQQMPPRHSAPGPKGDPECWPRKLGSRLEQLQAQMNSPGKG
RVSSGWQRILQLLQQPMPQGHFSYILEAPASNDLALFPIASETQSPGHRLPQDFLPSAQT
LSCGNLDNCSPKHGNSFPGMPHLAVATDKSLAPSSEQEQPEGLWPPLASPLHPLEVQGLI
CGPRFSSLPEQLGSVPKQLEFQRHGSDPGFAGSWGH
Download sequence
Identical sequences F7GZ63
ENSCJAP00000003807 ENSCJAP00000003807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]