SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004630 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004630
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000004630
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.000209
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004630   Gene: ENSCJAG00000002549   Transcript: ENSCJAT00000004883
Sequence length 162
Comment pep:novel chromosome:C_jacchus3.2.1:7:36977361:36978046:-1 gene:ENSCJAG00000002549 transcript:ENSCJAT00000004883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGVAPPPSAKATAAAARQPACGLWRPW
Download sequence
Identical sequences F6YLR5
ENSCJAP00000004630 ENSCJAP00000004635 XP_002750255.3.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]