SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004919 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004919
Domain Number 1 Region: 272-344
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004919   Gene: ENSCJAG00000007620   Transcript: ENSCJAT00000005186
Sequence length 347
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01170646.1:43663:45099:1 gene:ENSCJAG00000007620 transcript:ENSCJAT00000005186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYDIDYHCFYDYDCEDFCRSTAPGEGIWKKYELVPSPPTSLPWGLGPGTGHPTPGIGSP
RPSGGCAGDEAESRGHSKASGMNYTCIICHDCMWSGFWAQEQLERAVSDQLTSGTPRGNL
PKASATPDLPASKPQPGAAAPSPLGEPKTQACSGSESPSDLENDVTVEKRQFLGIRKPVT
TVRADPLDPCMKRFHISIHQQQHYTARFPPESCSQEEAPERGPQEEALERDTPGEKEDEE
DEEIVSLPPAESEATPSCHPKPGSSDTEDVTKRKNHNFLERKRQNDLRSRFLALRDQVPT
LASCSTATKVVILSKALGAEKWMATEKRQLRCQQQQLQKRIAYLSGY
Download sequence
Identical sequences H9KWE6
ENSCJAP00000014131 ENSCJAP00000004919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]