SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004941 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004941
Domain Number 1 Region: 4-209,280-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-58
Family BAR domain 0.000009
Further Details:      
 
Domain Number 2 Region: 413-461
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000548
Family SH3-domain 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004941   Gene: ENSCJAG00000002713   Transcript: ENSCJAT00000005209
Sequence length 461
Comment pep:novel chromosome:C_jacchus3.2.1:6:125254121:125277950:-1 gene:ENSCJAG00000002713 transcript:ENSCJAT00000005209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLQKLGKADVTKDEQFEQCVQNFNKQLTERTQLQKDLRTYLASVKAMHEASKKLNECLQ
EVYETDWPGRDEANKIAENNEVLWMDYHQKLVDQALLTMDTYLGQFLDIKSCIAKRGRKL
VDYYSARHHYESLQTAKKKEEAKIAKAEEELIKAQNVFEEMNVDLQEELPSLWNSLVGFY
VNTFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQRGSNTFMVKAQPSDNAPAKGNKSPS
PPDGSPAATPEIRVNQEPEPASGAMPGAALPKSLSQLRKGPPVPPPPKHTPSKEVKQEQI
LSLFEDTFVPEISVTTPSQPTESPAGSLPSREPSAAEGTFAVAWPSQTAEPGPAQPAEVS
EVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFLATVNGTVEGGSGAWCLDLPPGFM
FKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWL
Download sequence
Identical sequences F6UE15
ENSCJAP00000004937 ENSCJAP00000004941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]