SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005103 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005103
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.4e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005103   Gene: ENSCJAG00000002811   Transcript: ENSCJAT00000005377
Sequence length 179
Comment pep:known chromosome:C_jacchus3.2.1:4:134324227:134327306:1 gene:ENSCJAG00000002811 transcript:ENSCJAT00000005377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSLSDVEDLQEVEMLECEGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVNQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Download sequence
Identical sequences F7IM24
ENSCJAP00000005103 ENSCJAP00000005103 XP_002747027.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]