SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005353 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005353
Domain Number 1 Region: 251-318
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 
Domain Number 2 Region: 577-624
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000656
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 175-227
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005353   Gene: ENSCJAG00000035511   Transcript: ENSCJAT00000005647
Sequence length 629
Comment pep:novel chromosome:C_jacchus3.2.1:22:1268654:1746643:-1 gene:ENSCJAG00000035511 transcript:ENSCJAT00000005647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGVGLPDVGGGGGRACAAAARAPGARTADVTARGGAQAGRHSRRFATAGGAADGHRALRP
LRDRQTAARGEHRKRAAGERAAAPGGTLGSAVPPRPGASQAMPMAGSSGPTSSPRKSAPP
HAPTALHEPTAHPPPPPSSRLAIPATRPGSPGATKPRCCAAAERSWPGLIARLRVGRPGC
KIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGL
PGSAQGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPCSLS
PGMPENVDRAREEIKAPITLRTGAFPDAGPERDFHANGTDVCLDLLGAAASLWAKTPNPG
RRPPTATAGLRGDTALGAPEAFYAGSRGGPPVPDPGPASPYSGSSNPGFAFGAEDAGAAV
GTAAPEDCDFGFDFLALDLTVPAAATIWAPFERAAPLPAFSGCSTVNGAPGPPTTSARRS
SGAGTPRHSPTLPEPGSLRLELPLSRRGAPDPVGALSWRPPQGSLSFPGGAAFSTATSLP
GSPAATSCAPLDSGATSENSRKPPSASSAPAPALARECVVCAEGEVMAALVPCGHNLFCM
DCAVRICGKSEPECPACRTPATQAIHIFS
Download sequence
Identical sequences F7IH90
ENSCJAP00000005353 ENSCJAP00000005353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]