SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005555 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005555
Domain Number 1 Region: 1-168,201-215
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-56
Family Ribonuclease PH domain 1-like 0.0000000242
Further Details:      
 
Domain Number 2 Region: 185-299
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.04e-36
Family Ribonuclease PH domain 2-like 0.000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005555   Gene: ENSCJAG00000003038   Transcript: ENSCJAT00000005860
Sequence length 440
Comment pep:known chromosome:C_jacchus3.2.1:3:72169109:72183963:-1 gene:ENSCJAG00000003038 transcript:ENSCJAT00000005860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVS
CELVAPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLLERCLRNSKCIDTES
LCVVAGEKVWQIRVDLHLLNHDGNIIDAASVAAIVALCHFRRPDVSVQGDEVTLYTPEER
DPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGI
MLLKDQVLRCSKIAGVKVAEITELIQKALENDQKVRKEGGKFGFAESIANQRITAFKMEK
ASIDTSDVEEKAEEIIAEAEPPSEVVSKPVLWTPGTAQIGEGVENSWGDLEDSEKEDDDE
GGSDEAIILDSIKMDTGIEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTISVK
QEKAPNKKPVKRRKKKRAAN
Download sequence
Identical sequences F7IJD9
ENSCJAP00000005555 ENSCJAP00000005555 XP_002745482.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]