SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005912 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005912
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-78
Family IMD domain 0.00000000121
Further Details:      
 
Domain Number 2 Region: 361-422
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000184
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005912   Gene: ENSCJAG00000003222   Transcript: ENSCJAT00000006227
Sequence length 539
Comment pep:novel chromosome:C_jacchus3.2.1:5:130384202:130400458:1 gene:ENSCJAG00000003222 transcript:ENSCJAT00000006227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVL
FQMAEVHRQIQNQLEEMVQLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDAL
DKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRF
CFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGAAL
PSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQENTPIMNGVAGPDGEDYSPWT
DRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERN
GRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVEARDGWHYGESEKTKMRGWFPFSYTRVL
DSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGATSRAFPAQTASGFKQRPYSVAV
PAFSQGLEDYGARSMSRNPFAHVQLKPTVTNDRTKCDLSAQGPGGWEHQEGEPAPCGWN
Download sequence
Identical sequences F7IGR2
ENSCJAP00000005916 ENSCJAP00000005912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]