SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006092 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006092
Domain Number 1 Region: 2070-2114
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000053
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 832-1044
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000299
Family Extended AAA-ATPase domain 0.048
Further Details:      
 
Domain Number 3 Region: 475-598,640-710
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000872
Family Extended AAA-ATPase domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006092   Gene: ENSCJAG00000003340   Transcript: ENSCJAT00000006430
Sequence length 3279
Comment pep:novel chromosome:C_jacchus3.2.1:5:129642190:129662359:1 gene:ENSCJAG00000003340 transcript:ENSCJAT00000006430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCDADGEHCYLPSAFSQHKVLVTPQESLEAIQAYLACHYRVPEQTLSAAAVFRDRLCVG
IVASERAGVGKSLYVKRLHEKMKVQLRREKVPLKTIRLIDPQVDESQVLGALLPFLDVQY
QKVPMLFHLDVTSSVQTGIWVFLFKLLILQYLMDINGKMWLRSPCHLYIIEILERRTSVQ
SRRPSMLRTRAPQFSFLDIFPKVTCRPPKEVIDMELSPQRSDTEPGMDEWEFSSEAFQRP
YQYLKRFHQNQNLDKFQYQEGSVEGTPGECLQHFLIYCGVINPSWAELRNFARFLNYQLR
DCEASLFCNPSFTGDTLRGFKNFVVTFMILMARDFATPTLHTSDQSPGKHMVTMDGVREE
DLAPFSLRKSWESEPHPYVFFNHDHTSMTFIGFHLEPNSHGGVDAINHLTREVIKRDVMT
VDLYEGLLLQRVPFNVDFDRLPRHEKLERLCLALGIQWAIDPDDTYELTTDNMLKILAIE
MRFRCGIPVIIMGETGCGKTRLIKFLSDLRRGGANADTIKLVKVHGGTTADVIYSRVWEA
ENVAFSNKVQHQLDTILFFDEANTTEAISCIKEVLCDHTVDGQPLAEDSGLHIIAACNPY
RKHSEEMICRLESAGLGYRVSAEETADRLGSIPLRQLVYRVHALPPSLIPLVWDFGQLSD
TAEKLYIQQIVQRLVDSISLDQNETRIIIDILCASQGFMRRREDECSFVSLRDVERCMKV
FRWFHAHSAMLLAQLNSFLSRSSASKNHIEWRHPVLWSLLLAIGVCYHASLEKKDSYRKA
IARFFPKPYNDSRLLLDEITRVQDLFLDGVPLRKTIAKNLALKENVFIMVICIELKIPLF
LVGKPGSSKSLAKTIVADAMQGPAAHSDLFRSLKQVHLVSFQCSPHSTPQGIIGTFRQCA
RFQQGKDLQQYVSVVVLDEVGLAEDSPKMPLKALHPLLEDGCIEDDPAPHKKVGFVGISN
WALDPAKMNRGIFVSRGSPNERELIESAKGICSSDSLVQCRVQGYFAPFAKAYETMCRSQ
DKEFFGLRDYYSLIKMVFATARASNKKPSPREIAHAVLRNFSGKDDIHALDIFLANLPEA
LSSEEVNPVQLIRQNIFGPSQKGLGGQLEDGESRYLLVLTKNYVALQILQQTVFGEDQQP
EIIFGSGFPKDQEYTQICRNINRVKICMETGKMVVLLNLQNLYESLYDALNQYYVHLGGQ
NYVDLGLGTHRVKCRVHPNFRLIVIEEKEVVYTHFPIPLINRLEKHYLDINTVLEKWQKN
IVEELRAWVEKFVNVKAEQFLDRHKYSPSDVFIGYHSDACASVVLQAIKRQGPRALTEEL
YQQVSGEAKWILLNCATPDAVVRLSASLLDSFTAESLAHEYFYKQRHNSFADFLQEHLQA
TDLACHATFTEITTFSRLLTSHDCEILQSEITGGAPKPTLLWLQQFDTELSFLKEVRNCL
TNRAKCKILIIQTDFEDGIHSAQLIASAKYSAINEINKIQDSGDRIFVYFITKLSRMGSG
TAYVGFHGGLWQAVHIDDLRRSTVMVSDVTRLQSVTISQLFAPGESLTAVGLGHWVEDGG
EEAMEMEASMSGSVAEEAMETESSEKADKETSGLGGGDGQILDTTSLLRSCVQSAVGMLR
DQNKSCMRNMRRVVLLLGLFNEDSAGNASFLQVSKMRLNVLLKKQEDSQFHLLKEWVARE
ASNQDALQEAGTFRHTLWKRVQGAVTPLLASMISFIDRDGNLELLTRTGTPPWARDLWMF
IFSDKKLLNIPLVMNNSRRQGEMAYIVVQNHMNLSGSASNDVPFSWRIKDYLEELWVQAQ
YLTDAEGLPKRFVEIFQQNPLGRFLARLRGEQQQELLQCYSKDFILLTMRVSTREELQFL
QMALWSCICELKVALEVPEEEVSLPWVHLAYQHFRSRLQNFSRILTIYPQILCSLMEASQ
NHKLAEREMTLDVSAAMACTEMPTRHTLKPSPQAWLQLVKNLSMPLELICSDRHMQGSGT
LAQAVIREVRVHWSRIFSTALFVEHVLLEIERQVPELCRLVTEHVFLLDKRLRENSDLKT
HRPFRAVMSTLCECKESASRTFTRFGVQPCPICLGDAQDPVCLPCDHVYCLRCLEAWLVS
GQMMCPFCLTVLPDTFSPTVSQEHREAIEKHARLRQTCNSFFVDLVSTMCFKDNAPPEKE
VIHSLLSLLFVQKELLRDAPERHREHTKSLSPFNDVVDKTPVIRSVILKLLLKYSFDDVK
DYIQDYLTLLKKKAFIIEDKTELYMLFINCLEDSIHEKTSVCSRKDELNHLREEGVFLKT
YSPVRRGQEPAHEASVEYLQEVARIRLCLDRAADFLSEPQGGPEMAKEKECYLQQVKHFC
TRGENDWHRVYLVRKLSSQRGMEFVQGLSKPGHPCQWVFPKEVIEQQGLQKDHPGQMDWY
LVYGSEYKALRDAVAKAVLECKPLGTETALKACRTPRALQAAHFLLALFREVAVLYRSHN
ERLHPTPEQREAVSQFIGECKILSSTDIRHFATSLVDNSLPLLRAGPSNSSLEGTVTDMA
IHAAAVLLCGQNKVLEPLKNLAFSPADMANAFLPTMPEDLLAQARRWKGLEGVQWYTCPN
GHPCSVGECGRPMEQSFCVDCRAPIGGINHKPHDGFQMVSNSVDRTQSGHVLGNPQRRDL
VVTCDRELPPLVFIFIRLLTHLALLLGAAQSPQALMNIIKPPVRDPQGFLQQHILKDLEQ
LTKILRYSADETTSVVHLVLCRLLQEGNQLSGKRPLNFDTRLSTKENRNNWEKDIAAVIL
PELEHLDKTLPAVNILMSQDKRISSNPVAKIIYGDPVTFLPHLPRKSVVHCSKIWSCRKR
ITVEHLQHIMEQKNGKERVPILWHFLQKEAELRLVKFLPEILALQRELVKRFQNVPQAEY
RSIRGFISSHSSDGLRQLLQNRITIFLSTWNKLRKSLETNGEINLPQEYCSTDLDLDADF
EILLPRRRGLGLCATALVSYLIRLHNEIVYAVEKLSEENSSYSVDASEVTDLHVFSYEVE
RDLTPLILSNCQYQVEQGKETLQEFDLEKIQRQIISRFLQGKPRLSLKGIPTLVYRHDWN
YEHLFMDIKNKMPQTSLPSSTLSAISGQLQSYSDACEALSVIEVTLGFLSTAGGEPNMHL
NVYIQDVLRMGDQTAQVLQALNRCQLKHSIALWQFLSAHKSEQLLRLQKEPFGEISSRYK
ADLSPEDAKLLSTFLNQTGLDAFLLELHEMMVLKLKNPQTEGSFNPEWSLKDTLVSYMET
KESEILPEMESHFPEEILLASCVSVWKIAAALKRDRQMR
Download sequence
Identical sequences F7G9P9
ENSCJAP00000006092 ENSCJAP00000006093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]