SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006461 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006461
Domain Number 1 Region: 232-363
Classification Level Classification E-value
Superfamily PX domain 3.14e-27
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 389-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000384
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006461   Gene: ENSCJAG00000003470   Transcript: ENSCJAT00000006824
Sequence length 595
Comment pep:known chromosome:C_jacchus3.2.1:4:158856251:158973087:1 gene:ENSCJAG00000003470 transcript:ENSCJAT00000006824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNVKGERGLVPTDYVEIL
PSDGKDQFSCGNSVADQAFLDSLSASTTQASSSAASSNHQVGSGNDPWSAWSASKSGNWE
SSEGWGAKPDGAGAQRNTNTPDNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKD
SESADAGGVQRGNSRASASSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYG
PMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVK
FGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEK
EWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAE
QPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITPQDKQNMVKR
VSTMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Download sequence
Identical sequences F7GVW5
XP_008993550.1.60252 ENSCJAP00000006461 ENSCJAP00000006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]