SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006628 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006628
Domain Number 1 Region: 76-182
Classification Level Classification E-value
Superfamily WWE domain 4.71e-33
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000683
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006628   Gene: ENSCJAG00000003662   Transcript: ENSCJAT00000006998
Sequence length 359
Comment pep:known chromosome:C_jacchus3.2.1:4:127457459:127479157:1 gene:ENSCJAG00000003662 transcript:ENSCJAT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLC
VKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDER
TSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAG
LRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDGQLTSPATPSPDAS
TSLEDSFAHLQLSGDNIAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVS
AVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV
Download sequence
Identical sequences F7HB59
ENSCJAP00000006628 ENSCJAP00000006628 XP_002746982.1.60252 XP_003732773.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]