SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006692 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006692
Domain Number 1 Region: 58-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.59e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006692   Gene: ENSCJAG00000003689   Transcript: ENSCJAT00000007065
Sequence length 332
Comment pep:novel chromosome:C_jacchus3.2.1:4:17965955:17966983:1 gene:ENSCJAG00000003689 transcript:ENSCJAT00000007065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGEQYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSRKNMKLKE
RVLILVKQYPKINFVGTILGPQGNPIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP
KYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVP
EPSRGRGMPVRGRGAAPPPPPVPRGHGVGPPHGALVRGTPVRGAITRGATVTRGMPPPPT
VRAPRARTAGIQRISLPPPPAPETYEEYGYDDTYKGYEGYDSQSQGDSEYYDYGHGEEAY
GQDDWNGTRPSLKAPPARPVKGSYREHPYGRY
Download sequence
Identical sequences F7GIV9
ENSCJAP00000006692 ENSCJAP00000006692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]