SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006818 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006818
Domain Number 1 Region: 110-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006818   Gene: ENSCJAG00000003772   Transcript: ENSCJAT00000007202
Sequence length 272
Comment pep:novel chromosome:C_jacchus3.2.1:3:81124567:81125385:1 gene:ENSCJAG00000003772 transcript:ENSCJAT00000007202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPTSAALTPLSSSADEEEEEELGASGRAGPQHGAEAS
QGARGGVAAAAESCRPSRLLGLVHECKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSASSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Download sequence
Identical sequences F7DGJ1
ENSCJAP00000006818 XP_017826052.1.60252 ENSCJAP00000006821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]