SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007056 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007056
Domain Number 1 Region: 380-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.33e-47
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 134-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-37
Family Voltage-gated potassium channels 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007056   Gene: ENSCJAG00000003872   Transcript: ENSCJAT00000007455
Sequence length 664
Comment pep:novel chromosome:C_jacchus3.2.1:X:138675894:138681707:1 gene:ENSCJAG00000003872 transcript:ENSCJAT00000007455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKANGMKSSPANSHNHRAAPAIKASGKDDHRTSSRPHSTADDDTSSELQRLADVDAPQ
QRRGGFHRIVHLVGVIREWANKNFRQEEPRPDSFLERFRGPELQTVTTQQGDGKGDKDGE
DKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQHSYYLVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDMASIIPTDLIYFAVGI
HSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIRWFDYLWTNK
KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDEKEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITILETKMKQNNEDDYLSDGMNSPEPAA
DDKP
Download sequence
Identical sequences F6U3Q7
ENSCJAP00000007061 XP_017824178.1.60252 ENSCJAP00000007056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]