SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007302 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007302
Domain Number 1 Region: 238-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000289
Further Details:      
 
Domain Number 2 Region: 96-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.3e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 10-84
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007302   Gene: ENSCJAG00000004017   Transcript: ENSCJAT00000007714
Sequence length 314
Comment pep:known chromosome:C_jacchus3.2.1:1:83136759:83137811:-1 gene:ENSCJAG00000004017 transcript:ENSCJAT00000007714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIRKESGARIKILEGNCPERII
TLTGPTNAIFKAFAMIIYKLEEDINSSMTKSTAASRLVTLRLVVPATQCGSLIGKGGCKI
KEIRKSTGAQVQVAGDMLPNSTERAITIAGVPQSVTKCVKQICLVMLETLSHSPQGKVKT
ILYQPMPSRSPVTCAGGQDAYSIQGQHTISPLNLAKLNQVARQQSHFAMMHGGTGFAGID
SSSPEELTIPNNLIGCIIGRQGTNINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASIS
LAQYLIKARLSSEK
Download sequence
Identical sequences F6S7P4
ENSCJAP00000007302 ENSCJAP00000007302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]