SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007642 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007642
Domain Number 1 Region: 308-377
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000007642
Domain Number - Region: 368-456
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0502
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007642   Gene: ENSCJAG00000004199   Transcript: ENSCJAT00000008079
Sequence length 555
Comment pep:known chromosome:C_jacchus3.2.1:4:42908494:42964148:-1 gene:ENSCJAG00000004199 transcript:ENSCJAT00000008079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRQKTFSFGPGTRKLGFMSQLSPACSATLSKSLPLSGLGVFCKMDAIPVILASPQPTCFE
EDKCLTYLPPLLVHREPVPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQ
QQQLGGPPTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYG
NKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVI
DNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRE
LTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKAS
VDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAEL
AQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLS
FGGREDEGPPGYPEPLAPEHGSPFPGLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKA
SSRRSSFSMEEGDVL
Download sequence
Identical sequences F6U056
ENSCJAP00000007642 ENSCJAP00000007648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]