SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007850 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007850
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.87e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007850   Gene: ENSCJAG00000004331   Transcript: ENSCJAT00000008299
Sequence length 346
Comment pep:novel chromosome:C_jacchus3.2.1:16:59001343:59131568:-1 gene:ENSCJAG00000004331 transcript:ENSCJAT00000008299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYENSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
Download sequence
Identical sequences F7CMV6
ENSCJAP00000007850 XP_002759259.1.60252 XP_008981457.1.60252 XP_008981458.1.60252 XP_017821065.1.60252 ENSCJAP00000007855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]