SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007855 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007855
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.87e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007855   Gene: ENSCJAG00000004331   Transcript: ENSCJAT00000008304
Sequence length 346
Comment pep:known chromosome:C_jacchus3.2.1:16:59001343:59189413:-1 gene:ENSCJAG00000004331 transcript:ENSCJAT00000008304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSTLLPSISPTSSLLIPTLKHQARLINREIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYENSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
Download sequence
Identical sequences F7CMZ2
ENSCJAP00000007855 ENSCJAP00000007850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]