SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007873 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007873
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-24
Family PDZ domain 0.00000874
Further Details:      
 
Domain Number 2 Region: 536-638
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 3 Region: 321-428
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-18
Family PDZ domain 0.029
Further Details:      
 
Domain Number 4 Region: 808-918
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000186
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 5 Region: 639-711
Classification Level Classification E-value
Superfamily SH3-domain 0.000000353
Family SH3-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007873   Gene: ENSCJAG00000001713   Transcript: ENSCJAT00000008323
Sequence length 1222
Comment pep:known chromosome:C_jacchus3.2.1:1:99971837:100081336:1 gene:ENSCJAG00000001713 transcript:ENSCJAT00000008323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAQVLHRMWIQAVKKLGRWKGHVSPSASSPLVFPNLLWEGEGSKTTHTAPGMEELIWE
QYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNG
TPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAPLQASPPVDQDDRAFEVMDEFDGRS
FRSGYSERSRLSSHGERSRSWEDSPERGRPHERARSRSRERDLSRDWSRGRSLERGLDHD
HGRARDRNRGRSLERGLDHDFGPSQDRDRDRSRGRSIDQDYERSYRQAYDPDYDRAYSPE
YRRGAPYDVGSRGPRSRSRELPHSRSPSTEPRGQPGPIGVLLMKSRANEEYGLRLGSQIF
IKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQT
LINIPPLNDSDSEIEDISEIESNRSFSPEERRQQYSDYDYHSSSEKLKERPSSREDTPSR
LSRMGATPTPFKSTGDIAAAVVTETKKEPTYQEDSPVPQPKAAPRTFLRPSPEDEAIYGP
NTKMIRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVR
EDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRG
EVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRT
RGQRSGAKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLA
NELPDLFQAAKTEPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFP
IVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLFDQANKLKKTCPHLFTATINLNSANDSWF
GSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRLISDFEDTDGE
GGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPP
PAFKPEPPKAKTQNKEESFDFSKSYDYKSNPSAMAGNEIPGGSTKGYPPPVAAKPAFGRS
ILKPSTPLPPPEGEEVEESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARI
EIAQKHPDIYAVPIKTHKPDPDLPQHMSSRPPEPQKAPSRLYQDTRGSYGSDAEEEEYRQ
QLSEHSKRGYYGQSARYRDTEL
Download sequence
Identical sequences F7DWH5
ENSCJAP00000003122 ENSCJAP00000007873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]