SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008284 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008284
Domain Number 1 Region: 132-212
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-26
Family Translational machinery components 0.0035
Further Details:      
 
Domain Number 2 Region: 50-121
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.41e-22
Family Ribosomal S5 protein, N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008284   Gene: ENSCJAG00000004571   Transcript: ENSCJAT00000008756
Sequence length 247
Comment pep:novel chromosome:C_jacchus3.2.1:16:19115076:19115894:-1 gene:ENSCJAG00000004571 transcript:ENSCJAT00000008756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGACGGKAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEV
LKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVR
RGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSA
RGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQ
APAVATT
Download sequence
Identical sequences F7I664
ENSCJAP00000008284 ENSCJAP00000008284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]